PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang1097s00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 98aa    MW: 10830.2 Da    PI: 7.3843
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang1097s00010.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260115.53.3e-361188178
            DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavg 78
                      +CaaCk++rrkC+++Cv+apyfp ++p++fa+vhk+FGasnv kll++l+  +red+++sl+yeAear+rdPvy av+
  Vang1097s00010.1 11 PCAACKIQRRKCTQECVFAPYFPPDNPQRFAYVHKVFGASNVAKLLNELNAAQREDVVKSLAYEAEARLRDPVYEAVE 88
                      7*************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.9981097IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-361188IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MSSSLSSSNS PCAACKIQRR KCTQECVFAP YFPPDNPQRF AYVHKVFGAS NVAKLLNELN  60
AAQREDVVKS LAYEAEARLR DPVYEAVESG HHWVALE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150381e-163AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006578338.13e-52PREDICTED: LOB domain-containing protein 36-like
RefseqXP_006578337.13e-52PREDICTED: LOB domain-containing protein 36-like
RefseqXP_006581559.13e-52PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ35e-44LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0S3REJ92e-59A0A0S3REJ9_PHAAN; Uncharacterized protein
STRINGGLYMA04G11991.18e-52(Glycine max)
STRINGGLYMA06G11181.18e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-42ASYMMETRIC LEAVES 2-like 1